PDGFC Peptide - C-terminal region
PDGFC Peptide - C-terminal region
Product Specifications
UniProt
B4E3A5
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PDGFC Rabbit Polyclonal Antibody (orb585119) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GM-07-5 1 mL
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG, 5nm
Sign In for Pricing
View Details 
