Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OAF Peptide - N-terminal region

OAF Peptide - N-terminal region

Product Specifications

Product Name Alternative

NS5ATP13TP2

UniProt

Q86UD1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OAF Rabbit Polyclonal Antibody (orb585761) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848602

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Serine; threonine-protein phosphatase with EF-hands 1, PPEF1 ELISA KIT
E6155Hu-01 48 Well

Human Serine; threonine-protein phosphatase with EF-hands 1, PPEF1 ELISA KIT

Sign In for Pricing
View Details
Human Serine; threonine-protein phosphatase with EF-hands 1, PPEF1 ELISA KIT
E6155Hu-02 96 Well

Human Serine; threonine-protein phosphatase with EF-hands 1, PPEF1 ELISA KIT

Sign In for Pricing
View Details
Human Serine; threonine-protein phosphatase with EF-hands 1, PPEF1 ELISA KIT
E6155Hu-03 5x 96 Tests

Human Serine; threonine-protein phosphatase with EF-hands 1, PPEF1 ELISA KIT

Sign In for Pricing
View Details
Human Serine; threonine-protein phosphatase with EF-hands 1, PPEF1 ELISA KIT
E6155Hu-04 10x 96 Tests

Human Serine; threonine-protein phosphatase with EF-hands 1, PPEF1 ELISA KIT

Sign In for Pricing
View Details
Il17b Rabbit Polyclonal Antibody (FITC)
orb2122239 100 µL

Il17b Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
PTCH (Patched Homolog 1 (Drosophila), BCNS, FLJ26746, FLJ42602, HPE7, NBCCS, PTC, PTC1, PTCH, PTCH11) (Biotin)
MBS6172257-01 0.1 mL

PTCH (Patched Homolog 1 (Drosophila), BCNS, FLJ26746, FLJ42602, HPE7, NBCCS, PTC, PTC1, PTCH, PTCH11) (Biotin)

Sign In for Pricing
View Details