Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL14 Peptide - C-terminal region

MRPL14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

L14mt, L32mt, MRP-L14, MRP-L32, MRPL32, RMPL32, RPML32

UniProt

Q6P1L8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL14 Rabbit Polyclonal Antibody (orb587109) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115487

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MTPRFDSNNVVLIEDNGNPVGTRIKTPIPTSLRKREGEYSKVLAIAQNFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cib3 Mouse Gene Knockout Kit (CRISPR)
KN503345 1 Kit

Cib3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD66 (CEA) (C66/261), 0.2mg/mL
BNUB0261-100 1x 100 µL

CD66 (CEA) (C66/261), 0.2mg/mL

Sign In for Pricing
View Details
MFluor™ UV610 SE
1649-AAT 1 mg

MFluor™ UV610 SE

Sign In for Pricing
View Details
3-N-Boc-5'-O-DMT-3'-O-Nosyl Thymidine
TRC-N212160-25MG 25 mg

3-N-Boc-5'-O-DMT-3'-O-Nosyl Thymidine

Sign In for Pricing
View Details
GPR110 (ADGRF1) Human Gene Knockout Kit (CRISPR)
KN219437RB 1 Kit

GPR110 (ADGRF1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Bromo-6-chloronaphthalene
TRC-B682235-250MG 250 mg

2-Bromo-6-chloronaphthalene

Sign In for Pricing
View Details