Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL14 Peptide - C-terminal region

MRPL14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

L14mt, L32mt, MRP-L14, MRP-L32, MRPL32, RMPL32, RPML32

UniProt

Q6P1L8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL14 Rabbit Polyclonal Antibody (orb587109) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115487

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MTPRFDSNNVVLIEDNGNPVGTRIKTPIPTSLRKREGEYSKVLAIAQNFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Galectin-16 protein (N-His)
PKSH034190-01 20 µg

Recombinant Human Galectin-16 protein (N-His)

Sign In for Pricing
View Details
Recombinant Human Galectin-16 protein (N-His)
PKSH034190-02 100 µg

Recombinant Human Galectin-16 protein (N-His)

Sign In for Pricing
View Details
3,3’,5’-Triiodo-L-thyronine
TRC-T795350-10MG 10 mg

3,3’,5’-Triiodo-L-thyronine

Sign In for Pricing
View Details
Human LRRC57 activation kit by CRISPRa
GA116816 1 Kit

Human LRRC57 activation kit by CRISPRa

Sign In for Pricing
View Details
CD53 (161-2), Biotin conjugate, 0.1mg/mL
BNCB0324-100 1x 100 µL

CD53 (161-2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LYAR Antibody
8C15030-AAT 50 µg

LYAR Antibody

Sign In for Pricing
View Details