Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC121 Peptide - middle region

CCDC121 Peptide - middle region

Product Specifications

UniProt

J3KQZ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC121 Rabbit Polyclonal Antibody (orb326804) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001136155

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAMP2 (NM_014232) Human Over-expression Lysate
LS006844-20ug 20 µg

VAMP2 (NM_014232) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Dickkopf 1 (DKK1) ELISA Kit
GA-E0961MS-01 48 Tests

Mouse Dickkopf 1 (DKK1) ELISA Kit

Sign In for Pricing
View Details
Mouse Dickkopf 1 (DKK1) ELISA Kit
GA-E0961MS-02 96 Tests

Mouse Dickkopf 1 (DKK1) ELISA Kit

Sign In for Pricing
View Details
Epiregulin (EREG) BioAssayTM ECL ELISA Kit (Rat)
157572 96 Tests

Epiregulin (EREG) BioAssayTM ECL ELISA Kit (Rat)

Sign In for Pricing
View Details
Granulocyte-macrophage Colony-stimulating Factor, Recombinant, Bovine, aa18-143, His-Myc-Tag
584739-01 20 µg

Granulocyte-macrophage Colony-stimulating Factor, Recombinant, Bovine, aa18-143, His-Myc-Tag

Sign In for Pricing
View Details
Granulocyte-macrophage Colony-stimulating Factor, Recombinant, Bovine, aa18-143, His-Myc-Tag
584739-02 100 µg

Granulocyte-macrophage Colony-stimulating Factor, Recombinant, Bovine, aa18-143, His-Myc-Tag

Sign In for Pricing
View Details