Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF414 Peptide - C-terminal region

ZNF414 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZFP414

UniProt

A8MY94

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF414 Rabbit Polyclonal Antibody (orb573566) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115746

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPYLNPAPFGLSPPRLRPFLAAAPGPPASSAAVWKKSQGAGSSPRRPQGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mapenterol Hydrochloride
TRC-M187000-5MG 5 mg

Mapenterol Hydrochloride

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD28 Antibody[37.51]
E-AB-F10260-01 100 µg

AF/LE Purified Anti-Mouse CD28 Antibody[37.51]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD28 Antibody[37.51]
E-AB-F10260-02 1 mg

AF/LE Purified Anti-Mouse CD28 Antibody[37.51]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD28 Antibody[37.51]
E-AB-F10260-03 5 mg

AF/LE Purified Anti-Mouse CD28 Antibody[37.51]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD28 Antibody[37.51]
E-AB-F10260-04 25 mg

AF/LE Purified Anti-Mouse CD28 Antibody[37.51]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD28 Antibody[37.51]
E-AB-F10260-05 50 mg

AF/LE Purified Anti-Mouse CD28 Antibody[37.51]

Sign In for Pricing
View Details