Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFSD2A Peptide - N-terminal region

MFSD2A Peptide - N-terminal region

Product Specifications

UniProt

E7EPI8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MFSD2A Rabbit Polyclonal Antibody (orb580984) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr661-set siRNA/shRNA/RNAi Lentivector (Mouse)
33342094 4x 500 ng

Olfr661-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
GPR18 Rabbit Polyclonal Antibody (BF350)
orb2538672 100 µL

GPR18 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Lentiviral human C17orf97 shRNA (UAS) - Lentiviral human C17orf97 shRNA (UAS, iRFP) (25)
GTR15083846 1 Vial

Lentiviral human C17orf97 shRNA (UAS) - Lentiviral human C17orf97 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Chicken Leucine Aminopeptidase (LAP) ELISA Kit
abx355868 96 Well

Chicken Leucine Aminopeptidase (LAP) ELISA Kit

Sign In for Pricing
View Details
Klf3 Mouse shRNA Plasmid (Locus ID 16599)
TR501192 1 Kit

Klf3 Mouse shRNA Plasmid (Locus ID 16599)

Sign In for Pricing
View Details
E2-Tag Monoclonal Antibody
MBS8519220-01 0.1 mg

E2-Tag Monoclonal Antibody

Sign In for Pricing
View Details