Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFSD2A Peptide - N-terminal region

MFSD2A Peptide - N-terminal region

Product Specifications

UniProt

E7EPI8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MFSD2A Rabbit Polyclonal Antibody (orb580984) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAPDH Rabbit Monoclonal Antibody
E56G0311 100 µL

GAPDH Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TRAF4 (NM_004295) Human Over-expression Lysate
LS009618-100ug 100 µg

TRAF4 (NM_004295) Human Over-expression Lysate

Sign In for Pricing
View Details
Prokaryotic Rat Cluster Of Differentiation 19
RPU61052-01 50 µg

Prokaryotic Rat Cluster Of Differentiation 19

Sign In for Pricing
View Details
Prokaryotic Rat Cluster Of Differentiation 19
RPU61052-02 100 µg

Prokaryotic Rat Cluster Of Differentiation 19

Sign In for Pricing
View Details
Prokaryotic Rat Cluster Of Differentiation 19
RPU61052-03 1 mg

Prokaryotic Rat Cluster Of Differentiation 19

Sign In for Pricing
View Details
SYTL4 Antibody
orb128809-01 25 µg

SYTL4 Antibody

Sign In for Pricing
View Details