Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ULK1 Peptide - N-terminal region

ULK1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ATG1, ATG1A, UNC51, Unc51.1, hATG1

UniProt

O75385

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ULK1 Rabbit Polyclonal Antibody (orb582260) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003556

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(-) -Limonene
orb1299285-01 1 ml x 10 mM (in DMSO)

(-) -Limonene

Sign In for Pricing
View Details
(-) -Limonene
orb1299285-02 200 mg

(-) -Limonene

Sign In for Pricing
View Details
(-) -Limonene
orb1299285-03 500 mg

(-) -Limonene

Sign In for Pricing
View Details
(-) -Limonene
orb1299285-04 1 g

(-) -Limonene

Sign In for Pricing
View Details
Avadomide (CC-122) 200mg
A16854-200 200 mg

Avadomide (CC-122) 200mg

Sign In for Pricing
View Details
Mindbomb E3 Ubiquitin Protein Ligase 1 (MIB1) Antibody
abx329794-01 50 µg

Mindbomb E3 Ubiquitin Protein Ligase 1 (MIB1) Antibody

Sign In for Pricing
View Details