Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ULK1 Peptide - N-terminal region

ULK1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ATG1, ATG1A, UNC51, Unc51.1, hATG1

UniProt

O75385

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ULK1 Rabbit Polyclonal Antibody (orb582260) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003556

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbocisteine Lactam Sodium Salt
sc-460060 50 mg

Carbocisteine Lactam Sodium Salt

Sign In for Pricing
View Details
WASF5P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV755905 1.0 µg DNA

WASF5P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Desaturase 1 (FADS1)
MBS2112230-01 0.1 mL

Polyclonal Antibody to Fatty Acid Desaturase 1 (FADS1)

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Desaturase 1 (FADS1)
MBS2112230-02 0.2 mL

Polyclonal Antibody to Fatty Acid Desaturase 1 (FADS1)

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Desaturase 1 (FADS1)
MBS2112230-03 0.5 mL

Polyclonal Antibody to Fatty Acid Desaturase 1 (FADS1)

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Desaturase 1 (FADS1)
MBS2112230-04 1 mL

Polyclonal Antibody to Fatty Acid Desaturase 1 (FADS1)

Sign In for Pricing
View Details