GXYLT1 Peptide - C-terminal region
GXYLT1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
GLT8D3
UniProt
Q4G148
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GXYLT1 Rabbit Polyclonal Antibody (orb326756) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_775872
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LFVFPCQWNYRPDHCIYGSNCQEAEEGGIFILHGNRGVYHDDKQPAFRAV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470806-100 1x 100 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880050-500 1x 500 µL
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740096-500 1x 500 µL
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040270-500 1x 500 µL
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details