Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19orf66 Peptide - N-terminal region

C19orf66 Peptide - N-terminal region

Product Specifications

UniProt

Q9NUL5

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C19orf66 Rabbit Polyclonal Antibody (orb587088) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060851

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVELEKSVRRLREKFHGKVSSKKAGALMRKFGSDHTGVGRSIVYGVKQKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEX11G Antibody : Biotin (OAAF03989-Biotin)
OAAF03989-100UG-Biotin 100 µg

PEX11G Antibody : Biotin (OAAF03989-Biotin)

Sign In for Pricing
View Details
C17orf80 Knockout Hela Polyclonal Cells
ARG23575 1 Million

C17orf80 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
OR2AJ1 Antibody
MBS9508128-01 0.05 mL

OR2AJ1 Antibody

Sign In for Pricing
View Details
OR2AJ1 Antibody
MBS9508128-02 0.1 mL

OR2AJ1 Antibody

Sign In for Pricing
View Details
OR2AJ1 Antibody
MBS9508128-03 5x 0.1 mL

OR2AJ1 Antibody

Sign In for Pricing
View Details
4933405O20Rik sgRNA CRISPR Lentivector set (Mouse)
K3059101 3x 1.0 µg

4933405O20Rik sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details