Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19orf66 Peptide - N-terminal region

C19orf66 Peptide - N-terminal region

Product Specifications

UniProt

Q9NUL5

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C19orf66 Rabbit Polyclonal Antibody (orb587088) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060851

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVELEKSVRRLREKFHGKVSSKKAGALMRKFGSDHTGVGRSIVYGVKQKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ErbB-3 Monoclonal Antibody
JOT-MCA0503-01 20 µL

ErbB-3 Monoclonal Antibody

Sign In for Pricing
View Details
ErbB-3 Monoclonal Antibody
JOT-MCA0503-02 50 μL

ErbB-3 Monoclonal Antibody

Sign In for Pricing
View Details
ErbB-3 Monoclonal Antibody
JOT-MCA0503-03 100 µL

ErbB-3 Monoclonal Antibody

Sign In for Pricing
View Details
HL antibody
orb73919 100 µL

HL antibody

Sign In for Pricing
View Details
NAB2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E12]
TA804068AM 100 µL

NAB2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E12]

Sign In for Pricing
View Details
Rabbit Anti NDUFA12 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120ul
IRBAMLNDUFA12AP368120UL 120 µL

Rabbit Anti NDUFA12 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120ul

Sign In for Pricing
View Details