ZSWIM5 Peptide - C-terminal region
ZSWIM5 Peptide - C-terminal region
Product Specifications
UniProt
Q9P217
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZSWIM5 Rabbit Polyclonal Antibody (orb587103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065934
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ISPRHYGEFIEFLSKARETFLLPQDGHLQFAQFIDNLKQIYKGKKKLMLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681073-100 1x 100 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400977-500 1x 500 µL
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680843-500 1x 500 µL
CD106 / VCAM1 (VCAM1/843), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details