Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG101 Peptide - C-terminal region

ATG101 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C12orf44

UniProt

Q9BSB4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG101 Rabbit Polyclonal Antibody (orb587106) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068753

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crp 3'UTR GFP Stable Cell Line
TU154386 1.0 mL

Crp 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RETN Antibody
OACD06987-1ML 1 mL

RETN Antibody

Sign In for Pricing
View Details
MIR4283-1 ORF Vector (Human) (pORF)
ORF024257 1.0 µg DNA

MIR4283-1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Lentiviral mouse Gcdh shRNA (UAS) - Lentiviral mouse Gcdh shRNA (UAS, iRFP) plasmid
GTR15306031 1 Vial

Lentiviral mouse Gcdh shRNA (UAS) - Lentiviral mouse Gcdh shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Fish Cortisol, COR ELISA KIT
EA0004FI-01 96 Well

Fish Cortisol, COR ELISA KIT

Sign In for Pricing
View Details
Fish Cortisol, COR ELISA KIT
EA0004FI-02 5x 96 Tests

Fish Cortisol, COR ELISA KIT

Sign In for Pricing
View Details