Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG101 Peptide - C-terminal region

ATG101 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C12orf44

UniProt

Q9BSB4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG101 Rabbit Polyclonal Antibody (orb587106) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068753

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ebi3 (G-4) PE
sc-166158 PE 200 µg/mL

Ebi3 (G-4) PE

Sign In for Pricing
View Details
KLF12 (Kruppel-like Factor 12, AP-2rep, AP2REP, HSPC122) (MaxLight 405) discontinued
247953-ML405 100 µL

KLF12 (Kruppel-like Factor 12, AP-2rep, AP2REP, HSPC122) (MaxLight 405) discontinued

Sign In for Pricing
View Details
OmniPAGE Mini - PAGE Package with Power Supply
CVS10DSYS-PP500 1 Each

OmniPAGE Mini - PAGE Package with Power Supply

Sign In for Pricing
View Details
RNF165 Protein Vector (Mouse) (pPM-C-His)
PV224737 500 ng

RNF165 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Akt2 (F-7) FITC
sc-5270 FITC 200 µg/mL

Akt2 (F-7) FITC

Sign In for Pricing
View Details
Rasl11b-set siRNA/shRNA/RNAi Lentivector (Mouse)
38548094 4x 500 ng

Rasl11b-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details