OR51B2 Peptide - C-terminal region
OR51B2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
HOR5'Beta3, OR51B1P
UniProt
Q17R53
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR51B2 Rabbit Polyclonal Antibody (orb587125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_149420
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YRFGKNVPEVVHIIMSYIYFLFPSLMNPVIYSIKTKQIQYGIIRLLSKHR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Myotilin (MYOT) Mouse Monoclonal Antibody [Clone ID: OTI3D1]](https://cdn.genprice.uk/products/937/68dd18ba061270361e908644/imageurl/cf809573.webp)
CF809573 100 µg
Myotilin (MYOT) Mouse Monoclonal Antibody [Clone ID: OTI3D1]
Sign In for Pricing
View Details 
