Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51B2 Peptide - C-terminal region

OR51B2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HOR5'Beta3, OR51B1P

UniProt

Q17R53

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR51B2 Rabbit Polyclonal Antibody (orb587125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149420

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YRFGKNVPEVVHIIMSYIYFLFPSLMNPVIYSIKTKQIQYGIIRLLSKHR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant TRIM56 Antibody
RC-6406-01 50 μL

Recombinant TRIM56 Antibody

Sign In for Pricing
View Details
Recombinant TRIM56 Antibody
RC-6406-02 100 µL

Recombinant TRIM56 Antibody

Sign In for Pricing
View Details
Recombinant TRIM56 Antibody
RC-6406-03 1 mL

Recombinant TRIM56 Antibody

Sign In for Pricing
View Details
VGLL1 Human Gene Knockout Kit (CRISPR)
KN200600BN 1 Kit

VGLL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MET Human Gene Knockout Kit (CRISPR)
KN217003 1 Kit

MET Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dihydro Capsaicin-d3
TRC-D448752-1MG 1 mg

Dihydro Capsaicin-d3

Sign In for Pricing
View Details