Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDNF Peptide - N-terminal region

NDNF Peptide - N-terminal region

Product Specifications

Product Name Alternative

C4orf31

UniProt

Q8TB73

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDNF Rabbit Polyclonal Antibody (orb587130) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078850

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEWKLSLQELPEDRSGEGSGDLEPLEQQKQQIINEEGTELFSYKGNDVEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR1C Antibody
MBS8514715-01 0.1 mg

POLR1C Antibody

Sign In for Pricing
View Details
POLR1C Antibody
MBS8514715-02 0.1 mL (AF635)

POLR1C Antibody

Sign In for Pricing
View Details
POLR1C Antibody
MBS8514715-03 0.1 mL (AF610)

POLR1C Antibody

Sign In for Pricing
View Details
POLR1C Antibody
MBS8514715-04 0.1 mL (AF405S)

POLR1C Antibody

Sign In for Pricing
View Details
POLR1C Antibody
MBS8514715-05 0.1 mL (AF405L)

POLR1C Antibody

Sign In for Pricing
View Details
POLR1C Antibody
MBS8514715-06 0.1 mL (AF546)

POLR1C Antibody

Sign In for Pricing
View Details