Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDNF Peptide - N-terminal region

NDNF Peptide - N-terminal region

Product Specifications

Product Name Alternative

C4orf31

UniProt

Q8TB73

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDNF Rabbit Polyclonal Antibody (orb587130) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078850

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEWKLSLQELPEDRSGEGSGDLEPLEQQKQQIINEEGTELFSYKGNDVEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Liver
LS780795 150 µg

Tissue Protein Lysate, Liver

Sign In for Pricing
View Details
3,4-Dihydroxybenzophenone
sc-226236 5 g

3,4-Dihydroxybenzophenone

Sign In for Pricing
View Details
NDUFAF1 Rabbit Polyclonal Antibody
E10G08547 100 µL

NDUFAF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Gastrointestinalcancer Marker-CA199 ELISA Kit
201-11-0620 96 Tests

Rat Gastrointestinalcancer Marker-CA199 ELISA Kit

Sign In for Pricing
View Details
Recombinant MARV GP1/Envelope glycoprotein 1 Protein, C-His
EVV24302-01 100 µg

Recombinant MARV GP1/Envelope glycoprotein 1 Protein, C-His

Sign In for Pricing
View Details
Recombinant MARV GP1/Envelope glycoprotein 1 Protein, C-His
EVV24302-02 1 mg

Recombinant MARV GP1/Envelope glycoprotein 1 Protein, C-His

Sign In for Pricing
View Details