Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5orf44 Peptide - middle region

C5orf44 Peptide - middle region

Product Specifications

Product Name Alternative

C5orf44

UniProt

A5PLN9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C5orf44 Rabbit Polyclonal Antibody (orb587143) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079217

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THILVCAVSYTTQAGEKMYFRKFFKFQVLKPLDVKTKFYNAESDLSSVTD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR562899 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD18 Antibody[TS1/18.1.2.11]
E-AB-F1057M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD18 Antibody[TS1/18.1.2.11]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD18 Antibody[TS1/18.1.2.11]
E-AB-F1057M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD18 Antibody[TS1/18.1.2.11]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD18 Antibody[TS1/18.1.2.11]
E-AB-F1057M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD18 Antibody[TS1/18.1.2.11]

Sign In for Pricing
View Details
Cers3 Mouse Gene Knockout Kit (CRISPR)
KN503183 1 Kit

Cers3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N6-Succinyl Adenosine
TRC-S688825-1MG 1 mg

N6-Succinyl Adenosine

Sign In for Pricing
View Details