Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5orf44 Peptide - middle region

C5orf44 Peptide - middle region

Product Specifications

Product Name Alternative

C5orf44

UniProt

A5PLN9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C5orf44 Rabbit Polyclonal Antibody (orb587143) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079217

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THILVCAVSYTTQAGEKMYFRKFFKFQVLKPLDVKTKFYNAESDLSSVTD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin alpha E (ITGAE) Human Gene Knockout Kit (CRISPR)
KN417265 1 Kit

Integrin alpha E (ITGAE) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HOMER2 Mouse Monoclonal Antibody [Clone ID: OTI4G6]
CF806307 100 µg

HOMER2 Mouse Monoclonal Antibody [Clone ID: OTI4G6]

Sign In for Pricing
View Details
Human SLC27A6 activation kit by CRISPRa
GA109174 1 Kit

Human SLC27A6 activation kit by CRISPRa

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/2569R), CF647 conjugate, 0.1mg/mL
BNC472569-100 1x 100 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/2569R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GCKR Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E7]
TA502152BM 100 µL

GCKR Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E7]

Sign In for Pricing
View Details
Podophyllotoxin
TRC-P681000-10G 10 g

Podophyllotoxin

Sign In for Pricing
View Details