Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BBOF1 Peptide - N-terminal region

BBOF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CCDC176, C14orf45

UniProt

Q8ND07

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BBOF1 Rabbit Polyclonal Antibody (orb326813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079333

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DQEKDNMIEKLKQQLNETKEKAQEEKDKLEQKYTRQINELEGQFHQKAKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl N-boc-3-chloro-L-alaninate
TYD-04092-01 10 mg

Methyl N-boc-3-chloro-L-alaninate

Sign In for Pricing
View Details
Methyl N-boc-3-chloro-L-alaninate
TYD-04092-02 50 mg

Methyl N-boc-3-chloro-L-alaninate

Sign In for Pricing
View Details
1-[ (tert-butoxy) carbonyl]-4-methoxypiperidine-4-carboxylic acid
HTB04229-01 0.5 g

1-[ (tert-butoxy) carbonyl]-4-methoxypiperidine-4-carboxylic acid

Sign In for Pricing
View Details
1-[ (tert-butoxy) carbonyl]-4-methoxypiperidine-4-carboxylic acid
HTB04229-02 1 g

1-[ (tert-butoxy) carbonyl]-4-methoxypiperidine-4-carboxylic acid

Sign In for Pricing
View Details
1-[ (tert-butoxy) carbonyl]-4-methoxypiperidine-4-carboxylic acid
HTB04229-03 2 g

1-[ (tert-butoxy) carbonyl]-4-methoxypiperidine-4-carboxylic acid

Sign In for Pricing
View Details
1-[ (tert-butoxy) carbonyl]-4-methoxypiperidine-4-carboxylic acid
HTB04229-04 5 g

1-[ (tert-butoxy) carbonyl]-4-methoxypiperidine-4-carboxylic acid

Sign In for Pricing
View Details