WDCP Peptide - C-terminal region
WDCP Peptide - C-terminal region
Product Specifications
Product Name Alternative
PP384, C2orf44
UniProt
Q9H6R7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WDCP Rabbit Polyclonal Antibody (orb587150) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079479
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PPRLPQRKNLQSEKETYQLSKEVEILSRNLVEMQRCLSELTNRLHNGKKS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB1860-500 1x 500 µL
MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), 0.2mg/mL
Sign In for Pricing
View Details ![BTF3 Rabbit Monoclonal Antibody [Clone ID: 24GB6880]](https://cdn.genprice.uk/products/937/6868c301994c49e6dc3ed265/imageurl/ta425361.webp)
TA425361 100 µL
BTF3 Rabbit Monoclonal Antibody [Clone ID: 24GB6880]
Sign In for Pricing
View Details ![LXR alpha (NR1H3) Rabbit Monoclonal Antibody [Clone ID: R07-6A4]](https://cdn.genprice.uk/products/937/6868c2ff994c49e6dc3ec16c/imageurl/ta421919.webp)
TA421919 100 µL
LXR alpha (NR1H3) Rabbit Monoclonal Antibody [Clone ID: R07-6A4]
Sign In for Pricing
View Details ![ErbB3/HER3 Recombinant Rabbit Monoclonal Antibody [PD00-44]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea80e3a/imageurl/ha721194.webp)
HA721194 100 µL
ErbB3/HER3 Recombinant Rabbit Monoclonal Antibody [PD00-44]
Sign In for Pricing
View Details 
TP304196M 100 µg
ERK1 (MAPK3) (NM_002746) Human Recombinant Protein
Sign In for Pricing
View Details 