WDCP Peptide - C-terminal region
WDCP Peptide - C-terminal region
Product Specifications
Product Name Alternative
PP384, C2orf44
UniProt
Q9H6R7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WDCP Rabbit Polyclonal Antibody (orb587150) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079479
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PPRLPQRKNLQSEKETYQLSKEVEILSRNLVEMQRCLSELTNRLHNGKKS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740159-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (GP1.4), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
RD-NEFH-Hu-01 96 Tests
Human Neurofilament, Heavy Polypeptide (NEFH) ELISA Kit
Sign In for Pricing
View Details RD-NEFH-Hu-02 48 Tests
Human Neurofilament, Heavy Polypeptide (NEFH) ELISA Kit
Sign In for Pricing
View Details 