Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRTN Peptide - C-terminal region

SPRTN Peptide - C-terminal region

Product Specifications

Product Name Alternative

C1orf124, DDDL1880, PRO4323, Spartan, dJ876B10.3

UniProt

Q9H040

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPRTN Rabbit Polyclonal Antibody (orb326823) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114407

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QIKSSGNDPKYSTTTAQNSSSSSSQSKMVNCPVCQNEVLESQINEHLDWC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Non POU Domain Containing Octamer Binding Protein (NONO)
SIPJ186Hu01-01 10 µg

Recombinant Non POU Domain Containing Octamer Binding Protein (NONO)

Sign In for Pricing
View Details
Recombinant Non POU Domain Containing Octamer Binding Protein (NONO)
SIPJ186Hu01-02 50 µg

Recombinant Non POU Domain Containing Octamer Binding Protein (NONO)

Sign In for Pricing
View Details
Recombinant Non POU Domain Containing Octamer Binding Protein (NONO)
SIPJ186Hu01-03 200 µg

Recombinant Non POU Domain Containing Octamer Binding Protein (NONO)

Sign In for Pricing
View Details
Recombinant Non POU Domain Containing Octamer Binding Protein (NONO)
SIPJ186Hu01-04 1 mg

Recombinant Non POU Domain Containing Octamer Binding Protein (NONO)

Sign In for Pricing
View Details
Recombinant Non POU Domain Containing Octamer Binding Protein (NONO)
SIPJ186Hu01-05 5 mg

Recombinant Non POU Domain Containing Octamer Binding Protein (NONO)

Sign In for Pricing
View Details
PLEKHG2 Double Nickase Plasmid (h2)
sc-413048-NIC-2 20 µg

PLEKHG2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details