Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRTN Peptide - C-terminal region

SPRTN Peptide - C-terminal region

Product Specifications

Product Name Alternative

C1orf124, DDDL1880, PRO4323, Spartan, dJ876B10.3

UniProt

Q9H040

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPRTN Rabbit Polyclonal Antibody (orb326823) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114407

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QIKSSGNDPKYSTTTAQNSSSSSSQSKMVNCPVCQNEVLESQINEHLDWC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal A33/GPA33 Antibody (022) [Alexa Fluor 750]
NBP2-89872AF750 0.1 mL

Rabbit Monoclonal A33/GPA33 Antibody (022) [Alexa Fluor 750]

Sign In for Pricing
View Details
GCS1 Rabbit Polyclonal Antibody (Cy5.5)
orb1059842 100 µL

GCS1 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
PMCA1 Recombinant Antibody, HRP Conjugated
bsm-62073R-HRP 100 µL

PMCA1 Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
SYT15 Protein Vector (Mouse) (pPB-N-His)
PV235831 500 ng

SYT15 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
SRSF12 Protein Lysate (Rat) with C-HA Tag
45515036 100 µg

SRSF12 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Mmu-miR-7678-3p miRNA Antagomir
orb1911903-01 10 nmol

Mmu-miR-7678-3p miRNA Antagomir

Sign In for Pricing
View Details