SYDE2 Peptide - N-terminal region
SYDE2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RP11-33E12.1
UniProt
Q5VT97
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SYDE2 Rabbit Polyclonal Antibody (orb326826) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_115560
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ENRVLSVPPDQRITLTDLFENAYGSSMKGRELEELKDNIEFRGHKPLNSI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC742214-500 1x 500 µL
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (CDX2/2214), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
GA112996 1 Kit
Human Apolipoprotein L 4 (APOL4) activation kit by CRISPRa
Sign In for Pricing
View Details 
BNUM2755-50 1x 50 µL
Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), 1mg/mL
Sign In for Pricing
View Details 