Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYDE2 Peptide - N-terminal region

SYDE2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RP11-33E12.1

UniProt

Q5VT97

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYDE2 Rabbit Polyclonal Antibody (orb326826) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115560

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENRVLSVPPDQRITLTDLFENAYGSSMKGRELEELKDNIEFRGHKPLNSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fezakinumab Biosimilar - Research Grade
ICH5176-1mg 1 mg

Fezakinumab Biosimilar - Research Grade

Sign In for Pricing
View Details
LRRC23 (NM_201650) Human Recombinant Protein
TP306514M 100 µg

LRRC23 (NM_201650) Human Recombinant Protein

Sign In for Pricing
View Details
SMURF 2 (SMURF2) Human Gene Knockout Kit (CRISPR)
KN210866BN 1 Kit

SMURF 2 (SMURF2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse MUC5B (Mucin-5 Subtype B) ELISA Kit
E-EL-M0800-01 24 Tests

Mouse MUC5B (Mucin-5 Subtype B) ELISA Kit

Sign In for Pricing
View Details
Mouse MUC5B (Mucin-5 Subtype B) ELISA Kit
E-EL-M0800-02 48 Tests

Mouse MUC5B (Mucin-5 Subtype B) ELISA Kit

Sign In for Pricing
View Details
Mouse MUC5B (Mucin-5 Subtype B) ELISA Kit
E-EL-M0800-03 96 Tests

Mouse MUC5B (Mucin-5 Subtype B) ELISA Kit

Sign In for Pricing
View Details