GON7 Peptide - C-terminal region
GON7 Peptide - C-terminal region
Product Specifications
Product Name Alternative
PNAS-127, C14orf142
UniProt
Q9BXV9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GON7 Rabbit Polyclonal Antibody (orb326831) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_115879
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2122-500 1x 500 µL
Ubiquitin (Autophagy Marker) (UBB/2122), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![MRRF Mouse Monoclonal Antibody [Clone ID: AT7D10]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd6cf/imageurl/am50024pu-s.webp)
AM50024PU-S 50 µL
MRRF Mouse Monoclonal Antibody [Clone ID: AT7D10]
Sign In for Pricing
View Details 
