Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GON7 Peptide - C-terminal region

GON7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PNAS-127, C14orf142

UniProt

Q9BXV9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GON7 Rabbit Polyclonal Antibody (orb326831) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115879

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), 1mg/mL
BNUM1820-50 1x 50 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), 1mg/mL

Sign In for Pricing
View Details
Human SCNM1 activation kit by CRISPRa
GA112305 1 Kit

Human SCNM1 activation kit by CRISPRa

Sign In for Pricing
View Details
USP38 Human Gene Knockout Kit (CRISPR)
KN208974 1 Kit

USP38 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OBSCN Human Gene Knockout Kit (CRISPR)
KN422861 1 Kit

OBSCN Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human F9 (Coagulation Factor IX) CLIA Kit
E-CL-H0546-01 24 Tests

Human F9 (Coagulation Factor IX) CLIA Kit

Sign In for Pricing
View Details
Human F9 (Coagulation Factor IX) CLIA Kit
E-CL-H0546-02 48 Tests

Human F9 (Coagulation Factor IX) CLIA Kit

Sign In for Pricing
View Details