Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLIP Peptide - N-terminal region

MLIP Peptide - N-terminal region

Product Specifications

UniProt

A6NDT1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MLIP Rabbit Polyclonal Antibody (orb587175) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPTVRRLPTHTQLADTSKFLVKIPEESSDKSPETVNRSKSNDYLTLNAGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mili (D14F5) XP® Rabbit Monoclonal Antibody
CST 5940S 100 µL

Mili (D14F5) XP® Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Receptor Superfamily Member 10C (CD263) ELISA Kit
MBS8420083-01 1 Kit

Human Tumor Necrosis Factor Receptor Superfamily Member 10C (CD263) ELISA Kit

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Receptor Superfamily Member 10C (CD263) ELISA Kit
MBS8420083-02 5x 1 Kit

Human Tumor Necrosis Factor Receptor Superfamily Member 10C (CD263) ELISA Kit

Sign In for Pricing
View Details
GPI8, NT (GPI-anchor Transamidase, GPI Transamidase, Phosphatidylinositol-glycan Biosynthesis, Class K Protein, PIG-K, hGPI8, GPI8 Homolog, PIGK) (MaxLight 750)
MBS6478042-01 0.1 mL

GPI8, NT (GPI-anchor Transamidase, GPI Transamidase, Phosphatidylinositol-glycan Biosynthesis, Class K Protein, PIG-K, hGPI8, GPI8 Homolog, PIGK) (MaxLight 750)

Sign In for Pricing
View Details
GPI8, NT (GPI-anchor Transamidase, GPI Transamidase, Phosphatidylinositol-glycan Biosynthesis, Class K Protein, PIG-K, hGPI8, GPI8 Homolog, PIGK) (MaxLight 750)
MBS6478042-02 5x 0.1 mL

GPI8, NT (GPI-anchor Transamidase, GPI Transamidase, Phosphatidylinositol-glycan Biosynthesis, Class K Protein, PIG-K, hGPI8, GPI8 Homolog, PIGK) (MaxLight 750)

Sign In for Pricing
View Details
N-cadherin CRISPR/Cas9 KO Plasmid (h2)
sc-400109-KO-2 20 µg

N-cadherin CRISPR/Cas9 KO Plasmid (h2)

Sign In for Pricing
View Details