Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC189 Peptide - C-terminal region

CCDC189 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C16orf93

UniProt

A1A4V9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC189 Rabbit Polyclonal Antibody (orb326846) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001182549

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKTQVNKELEQLQGLVEERLKASEERLSSKLTALERPFQLPPGKGKSKTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C16orf47 activation kit by CRISPRa
GA117939 1 Kit

Human C16orf47 activation kit by CRISPRa

Sign In for Pricing
View Details
Tmem81 Mouse Gene Knockout Kit (CRISPR)
KN517903 1 Kit

Tmem81 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-(Dithiocarboxy)sarcosine Diammonium Salt
TRC-D494350-250MG 250 mg

N-(Dithiocarboxy)sarcosine Diammonium Salt

Sign In for Pricing
View Details
Human GANAB, C-His Tag
HA210610-01 20 µg

Human GANAB, C-His Tag

Sign In for Pricing
View Details
Human GANAB, C-His Tag
HA210610-02 50 µg

Human GANAB, C-His Tag

Sign In for Pricing
View Details
Human GANAB, C-His Tag
HA210610-03 100 µg

Human GANAB, C-His Tag

Sign In for Pricing
View Details