Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC189 Peptide - C-terminal region

CCDC189 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C16orf93

UniProt

A1A4V9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC189 Rabbit Polyclonal Antibody (orb326846) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001182549

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKTQVNKELEQLQGLVEERLKASEERLSSKLTALERPFQLPPGKGKSKTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: right
CS702731 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF488A conjugate, 0.1mg/mL
BNC881260-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KLF7 Mouse Monoclonal Antibody [Clone ID: OTI8D7]
CF812009 100 µg

KLF7 Mouse Monoclonal Antibody [Clone ID: OTI8D7]

Sign In for Pricing
View Details
Tissue Total RNA, Colon: right
CR561039 5 µg

Tissue Total RNA, Colon: right

Sign In for Pricing
View Details
Human ADAMTS16 activation kit by CRISPRa
GA116222 1 Kit

Human ADAMTS16 activation kit by CRISPRa

Sign In for Pricing
View Details
Acyltransferase like 1 (LPCAT2) (NM_017839) Human Over-expression Lysate
LY402622 100 µg

Acyltransferase like 1 (LPCAT2) (NM_017839) Human Over-expression Lysate

Sign In for Pricing
View Details