Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM52B Peptide - C-terminal region

TMEM52B Peptide - C-terminal region

Product Specifications

UniProt

Q4KMG9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM52B Rabbit Polyclonal Antibody (orb326859) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694567

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGQLPSSLDTLPGYEEALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFI16 Rabbit Polyclonal Antibody (BF405)
orb2511649 100 µL

IFI16 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
ANAPC5 Antibody
orb195144-01 50 μL

ANAPC5 Antibody

Sign In for Pricing
View Details
ANAPC5 Antibody
orb195144-02 100 µL

ANAPC5 Antibody

Sign In for Pricing
View Details
Mrgpra2b Protein Vector (Mouse) (pPM-C-HA)
30397024 500 ng

Mrgpra2b Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
H-D-Tyr (tBu) -allyl ester · HCl
4027186.0005 5 g

H-D-Tyr (tBu) -allyl ester · HCl

Sign In for Pricing
View Details
Carfilzomib (2R,4S) -diol
RLC17275-01 5 mg

Carfilzomib (2R,4S) -diol

Sign In for Pricing
View Details