Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM52B Peptide - C-terminal region

TMEM52B Peptide - C-terminal region

Product Specifications

UniProt

Q4KMG9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM52B Rabbit Polyclonal Antibody (orb326859) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694567

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGQLPSSLDTLPGYEEALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Flexneri zapB Protein (aa 1-81)
VAng-Lsx08513-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Flexneri zapB Protein (aa 1-81)

Sign In for Pricing
View Details
ZNF524 Human siRNA Oligo Duplex (Locus ID 147807)
SR315611 1 Kit

ZNF524 Human siRNA Oligo Duplex (Locus ID 147807)

Sign In for Pricing
View Details
HOMER1 Polyclonal Antibody
E55A01327 100 µg

HOMER1 Polyclonal Antibody

Sign In for Pricing
View Details
RGD1563072 AAV siRNA Pooled Vector
39312166 1.0 µg

RGD1563072 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Rabbit anti-human host cell factor C1 (VP16-accessory protein) polyclonal Antibody
MBS716204-01 0.1 mL

Rabbit anti-human host cell factor C1 (VP16-accessory protein) polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human host cell factor C1 (VP16-accessory protein) polyclonal Antibody
MBS716204-02 5x 0.1 mL

Rabbit anti-human host cell factor C1 (VP16-accessory protein) polyclonal Antibody

Sign In for Pricing
View Details