C20orf96 Peptide - N-terminal region
C20orf96 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DJ1103G7.2
UniProt
B7ZML9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C20orf96 Rabbit Polyclonal Antibody (orb587225) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_542138
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SIVQEFQVPDYVPWQQSKQETKPSTLPPVQQANSLHTSKMKTLTRVQPVF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881037-500 1x 500 µL
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040040-500 1x 500 µL
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details