INTS2 Peptide - N-terminal region
INTS2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
INT2, KIAA1287
UniProt
Q9H0H0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INTS2 Rabbit Polyclonal Antibody (orb587464) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065799
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VCRGLIKNGERQDEESLGGRRRTDALRFLCKMNPSQALKVRGMVVEECHL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15296199 1 Vial
Lentiviral mouse Cybb shRNA (UAS) - Lentiviral mouse Cybb shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details 
