Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS2 Peptide - N-terminal region

INTS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

INT2, KIAA1287

UniProt

Q9H0H0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INTS2 Rabbit Polyclonal Antibody (orb587464) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065799

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VCRGLIKNGERQDEESLGGRRRTDALRFLCKMNPSQALKVRGMVVEECHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIST Antibody Blocking peptide
orb1446803 500 µg

PIST Antibody Blocking peptide

Sign In for Pricing
View Details
Human Papillomavirus Antibody (HPV-Ab) ELISA Kit
orb2811337-01 48 Tests

Human Papillomavirus Antibody (HPV-Ab) ELISA Kit

Sign In for Pricing
View Details
Human Papillomavirus Antibody (HPV-Ab) ELISA Kit
orb2811337-02 96 Tests

Human Papillomavirus Antibody (HPV-Ab) ELISA Kit

Sign In for Pricing
View Details
Human Papillomavirus Antibody (HPV-Ab) ELISA Kit
orb2811337-03 5 x 96 T

Human Papillomavirus Antibody (HPV-Ab) ELISA Kit

Sign In for Pricing
View Details
Smox Antibody
orb25763-01 50 µg

Smox Antibody

Sign In for Pricing
View Details
Smox Antibody
orb25763-02 100 µg

Smox Antibody

Sign In for Pricing
View Details