KBTBD6 Peptide - N-terminal region
KBTBD6 Peptide - N-terminal region
Product Specifications
UniProt
Q86V97
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KBTBD6 Rabbit Polyclonal Antibody (orb327006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_690867
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QSREDAPRSRRLASPRGGKRPKKIHKPTVSAFFTGPEELKDTAHSAALLA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PIP5K3 (PIKFYVE) Mouse Monoclonal Antibody [Clone ID: OTI1D3]](https://cdn.genprice.uk/products/937/68dd18ba061270361e90882f/imageurl/cf810373.webp)
CF810373 100 µg
PIP5K3 (PIKFYVE) Mouse Monoclonal Antibody [Clone ID: OTI1D3]
Sign In for Pricing
View Details 
LC424648 20 µg
Thyroid Peroxidase (TPO) (NM_000547) Human Over-expression Lysate
Sign In for Pricing
View Details 
![GTF3C4 Mouse Monoclonal Antibody [Clone ID: OTI3D4]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908dc3/imageurl/cf812626.webp)
CF812626 100 µg
GTF3C4 Mouse Monoclonal Antibody [Clone ID: OTI3D4]
Sign In for Pricing
View Details 
