Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KBTBD6 Peptide - N-terminal region

KBTBD6 Peptide - N-terminal region

Product Specifications

UniProt

Q86V97

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KBTBD6 Rabbit Polyclonal Antibody (orb327006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_690867

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSREDAPRSRRLASPRGGKRPKKIHKPTVSAFFTGPEELKDTAHSAALLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2D4 Human Gene Knockout Kit (CRISPR)
KN402473 1 Kit

UBE2D4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PCDHB11 (N-term) Rabbit Polyclonal Antibody
AP53206PU-N 400 µL

PCDHB11 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
rac 4-Hydroxy Ephedrine-d3 Hydrochloride
TRC-H825304-1MG 1 mg

rac 4-Hydroxy Ephedrine-d3 Hydrochloride

Sign In for Pricing
View Details
SIRT1 Mouse Monoclonal Antibody [Clone ID: 1F3]
AM06495SU-N 100 µL

SIRT1 Mouse Monoclonal Antibody [Clone ID: 1F3]

Sign In for Pricing
View Details
Andarine
TRC-A637470-5MG 5 mg

Andarine

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB600829 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details