Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KBTBD12 Peptide - N-terminal region

KBTBD12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KLHDC6

UniProt

Q3ZCT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KBTBD12 Rabbit Polyclonal Antibody (orb327008) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997218

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FAKQIGAEDLSDRSKKYLYQHFAEVSLHEEILEIEVHQFLTLIKSDDLNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BRWD3 activation kit by CRISPRa
GA116769 1 Kit

Human BRWD3 activation kit by CRISPRa

Sign In for Pricing
View Details
Nofmer MSD
TRC-N636280-500MG 500 mg

Nofmer MSD

Sign In for Pricing
View Details
3-Hydroxyhomophthalic Acid
TRC-H942843-1G 1 g

3-Hydroxyhomophthalic Acid

Sign In for Pricing
View Details
TMEM16A (ANO1) Mouse Monoclonal Antibody [Clone ID: SPM580]
AM50156PU-S 100 µg

TMEM16A (ANO1) Mouse Monoclonal Antibody [Clone ID: SPM580]

Sign In for Pricing
View Details
S100P binding protein (S100PBP) Human Gene Knockout Kit (CRISPR)
KN402353 1 Kit

S100P binding protein (S100PBP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glycidyl Oleate
TRC-G615930-10MG 10 mg

Glycidyl Oleate

Sign In for Pricing
View Details