Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KBTBD12 Peptide - N-terminal region

KBTBD12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KLHDC6

UniProt

Q3ZCT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KBTBD12 Rabbit Polyclonal Antibody (orb327008) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997218

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FAKQIGAEDLSDRSKKYLYQHFAEVSLHEEILEIEVHQFLTLIKSDDLNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1’-Oxobufuralol Hydrochloride
TRC-O847500-10MG 10 mg

1’-Oxobufuralol Hydrochloride

Sign In for Pricing
View Details
Purified Anti-Human CD47 Antibody[CC2C6D4]
E-AB-F1060A-01 25 µg

Purified Anti-Human CD47 Antibody[CC2C6D4]

Sign In for Pricing
View Details
Purified Anti-Human CD47 Antibody[CC2C6D4]
E-AB-F1060A-02 100 µg

Purified Anti-Human CD47 Antibody[CC2C6D4]

Sign In for Pricing
View Details
Human GLUT8 (SLC2A8) activation kit by CRISPRa
GA109360 1 Kit

Human GLUT8 (SLC2A8) activation kit by CRISPRa

Sign In for Pricing
View Details
Neoabietic Acid
TRC-N389900-1MG 1 mg

Neoabietic Acid

Sign In for Pricing
View Details
GBA (C-term) Rabbit Polyclonal Antibody
AP46301PU-N 100 µL

GBA (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details