Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TANK Peptide - N-terminal region

TANK Peptide - N-terminal region

Product Specifications

UniProt

E7EVA2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TANK Rabbit Polyclonal Antibody (orb573597) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILYSDATGRRGMDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL2 / MCP-1 Polyclonal Antibody
ANT-10614-50ug 50 µg

CCL2 / MCP-1 Polyclonal Antibody

Sign In for Pricing
View Details
Centrin 1 (CETN1) Mouse Monoclonal Antibody [Clone 9D2]
E45M16391V-2 50 µL

Centrin 1 (CETN1) Mouse Monoclonal Antibody [Clone 9D2]

Sign In for Pricing
View Details
DUS1L (NM_022156) Human Recombinant Protein
TP309015 20 µg

DUS1L (NM_022156) Human Recombinant Protein

Sign In for Pricing
View Details
Kayaflavone
TBZ0530 unit

Kayaflavone

Sign In for Pricing
View Details
Remifentanil Ep Impurity N
CS-TB-82520 1 Each

Remifentanil Ep Impurity N

Sign In for Pricing
View Details
Anti-CD4 antibody
STJ140023 150 µg

Anti-CD4 antibody

Sign In for Pricing
View Details