Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TANK Peptide - N-terminal region

TANK Peptide - N-terminal region

Product Specifications

UniProt

E7EVA2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TANK Rabbit Polyclonal Antibody (orb573597) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILYSDATGRRGMDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANGPTL6 Rabbit Polyclonal Antibody
orb584724 100 µL

ANGPTL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HPS6 (NM_024747) Human Untagged Clone
SC321021 10 µg

HPS6 (NM_024747) Human Untagged Clone

Sign In for Pricing
View Details
Cleaved-Lamin A (D230) Polyclonal Antibody
ABP50042-01 30 µL

Cleaved-Lamin A (D230) Polyclonal Antibody

Sign In for Pricing
View Details
Cleaved-Lamin A (D230) Polyclonal Antibody
ABP50042-02 100 µL

Cleaved-Lamin A (D230) Polyclonal Antibody

Sign In for Pricing
View Details
Cleaved-Lamin A (D230) Polyclonal Antibody
ABP50042-03 200 µL

Cleaved-Lamin A (D230) Polyclonal Antibody

Sign In for Pricing
View Details
Human Topoisomerase III (TOP3) CLIA Kit
abx494391-01 96 Tests

Human Topoisomerase III (TOP3) CLIA Kit

Sign In for Pricing
View Details