Itsn1 Peptide - middle region
Itsn1 Peptide - middle region
Product Specifications
Product Name Alternative
AA517634, AA545208, AI316805, AI839402, AI848451, Ehsh1, Ese1, Itsn, Sh3p17
UniProt
Q6NZJ5
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Itsn1 Rabbit Polyclonal Antibody (orb576202) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001103746
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IPPSFRRVRSGSGMSVISSSSVDQRLPEEPSSEDEQQPEKKLPVTFEDKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
17528004 1 Each
Protein A Sepherose 4 Fast Flow (AKTA Compatible) - EACH
Sign In for Pricing
View Details 495807 100 µL
ZBED1 (Zinc Finger BED Domain-Containing Protein 1, Zinc Finger BED Domain-Containing 1)
Sign In for Pricing
View Details 