Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Itsn1 Peptide - middle region

Itsn1 Peptide - middle region

Product Specifications

Product Name Alternative

AA517634, AA545208, AI316805, AI839402, AI848451, Ehsh1, Ese1, Itsn, Sh3p17

UniProt

Q6NZJ5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Itsn1 Rabbit Polyclonal Antibody (orb576202) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001103746

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IPPSFRRVRSGSGMSVISSSSVDQRLPEEPSSEDEQQPEKKLPVTFEDKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse ECE2 (Endothelin Converting Enzyme 2) ELISA Kit
EM23262 96 Tests

Mouse ECE2 (Endothelin Converting Enzyme 2) ELISA Kit

Sign In for Pricing
View Details
RACK1 Antibody
orb521432-01 50 μL

RACK1 Antibody

Sign In for Pricing
View Details
RACK1 Antibody
orb521432-02 100 µL

RACK1 Antibody

Sign In for Pricing
View Details
CA11 Blocking Peptide
MBS9628356-01 1 mg

CA11 Blocking Peptide

Sign In for Pricing
View Details
CA11 Blocking Peptide
MBS9628356-02 5x 1 mg

CA11 Blocking Peptide

Sign In for Pricing
View Details
CALB1 siRNA (Rat)
MBS8213684-01 15 nmol

CALB1 siRNA (Rat)

Sign In for Pricing
View Details