Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Xdh Peptide - N-terminal region

Xdh Peptide - N-terminal region

Product Specifications

Product Name Alternative

XOR

UniProt

P22985

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Xdh Rabbit Polyclonal Antibody (orb585600) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058850

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP1 Polyclonal Antibody
MBS2554143-01 0.06 mL

MMP1 Polyclonal Antibody

Sign In for Pricing
View Details
MMP1 Polyclonal Antibody
MBS2554143-02 0.12 mL

MMP1 Polyclonal Antibody

Sign In for Pricing
View Details
MMP1 Polyclonal Antibody
MBS2554143-03 0.2 mL

MMP1 Polyclonal Antibody

Sign In for Pricing
View Details
MMP1 Polyclonal Antibody
MBS2554143-04 5x 0.2 mL

MMP1 Polyclonal Antibody

Sign In for Pricing
View Details
CD45RB (BRA-11G), CF594 conjugate, 0.1mg/mL
BNC940174-500 1x 500 µL

CD45RB (BRA-11G), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLC22A12 (2B5)
sc-293405 100 µg/mL

SLC22A12 (2B5)

Sign In for Pricing
View Details