Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Xdh Peptide - N-terminal region

Xdh Peptide - N-terminal region

Product Specifications

Product Name Alternative

XOR

UniProt

P22985

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Xdh Rabbit Polyclonal Antibody (orb585600) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058850

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Septin-2
7-06346 2 µg

Recombinant Human Septin-2

Sign In for Pricing
View Details
Mouse Interleukin-36 alpha (IL1F6) Elisa Kit
EK731969 96 Well

Mouse Interleukin-36 alpha (IL1F6) Elisa Kit

Sign In for Pricing
View Details
Mbp (Myelin basic protein S) BioAssayTM ELISA Kit (Rat) discontinued
357233-01 48 Tests

Mbp (Myelin basic protein S) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Mbp (Myelin basic protein S) BioAssayTM ELISA Kit (Rat) discontinued
357233-02 96 Tests

Mbp (Myelin basic protein S) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
TRDN
579915-01 50 µg

TRDN

Sign In for Pricing
View Details
TRDN
579915-02 100 µg

TRDN

Sign In for Pricing
View Details