Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHOC2 Peptide - N-terminal region

SHOC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SIAA0862, SOC2, SUR8

UniProt

Q9UQ13

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHOC2 Rabbit Polyclonal Antibody (orb586242) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031399

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPSSIKELTQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPA5 (NM_001127442) Human Tagged ORF Clone Lentiviral Particle
RC225630L4V 200 µL

CPA5 (NM_001127442) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
HSF1, Phosphorylated (S307) (Heat Shock Factor 1, HSTF1) (AP)
MBS6421513-01 0.1 mL

HSF1, Phosphorylated (S307) (Heat Shock Factor 1, HSTF1) (AP)

Sign In for Pricing
View Details
HSF1, Phosphorylated (S307) (Heat Shock Factor 1, HSTF1) (AP)
MBS6421513-02 5x 0.1 mL

HSF1, Phosphorylated (S307) (Heat Shock Factor 1, HSTF1) (AP)

Sign In for Pricing
View Details
3,5-Difluorophenacyl bromide
PC4473-01 1 g

3,5-Difluorophenacyl bromide

Sign In for Pricing
View Details
3,5-Difluorophenacyl bromide
PC4473-02 5 g

3,5-Difluorophenacyl bromide

Sign In for Pricing
View Details
Smad6 (NM_008542) Mouse Untagged Clone
MC204474 10 µg

Smad6 (NM_008542) Mouse Untagged Clone

Sign In for Pricing
View Details