Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHOC2 Peptide - N-terminal region

SHOC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SIAA0862, SOC2, SUR8

UniProt

Q9UQ13

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHOC2 Rabbit Polyclonal Antibody (orb586242) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031399

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPSSIKELTQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cyclophilin B ELISA Kit
IHUCYPBKT 1 Each

Human Cyclophilin B ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Lambda5/IGLL1 Antibody [mFluor Violet 610 SE]
NBP2-98929MFV610 0.1 mL

Rabbit Polyclonal Lambda5/IGLL1 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
AHSG (Alpha-2-HS-Glycoprotein, Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein, Fetuin-A, FETUA, PRO2743) (MaxLight 750)
MBS6369141-01 0.1 mL

AHSG (Alpha-2-HS-Glycoprotein, Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein, Fetuin-A, FETUA, PRO2743) (MaxLight 750)

Sign In for Pricing
View Details
AHSG (Alpha-2-HS-Glycoprotein, Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein, Fetuin-A, FETUA, PRO2743) (MaxLight 750)
MBS6369141-02 5x 0.1 mL

AHSG (Alpha-2-HS-Glycoprotein, Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein, Fetuin-A, FETUA, PRO2743) (MaxLight 750)

Sign In for Pricing
View Details
Culture Medium for Human Pancreatic Cancer Cells [MIA-PACA-2]
AFG-ELL-1543-01 125 mL

Culture Medium for Human Pancreatic Cancer Cells [MIA-PACA-2]

Sign In for Pricing
View Details
Culture Medium for Human Pancreatic Cancer Cells [MIA-PACA-2]
AFG-ELL-1543-02 500 mL

Culture Medium for Human Pancreatic Cancer Cells [MIA-PACA-2]

Sign In for Pricing
View Details